Web Analytics
518-831-8000 sales@utechproducts.com

Tnfrsf13b Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tnfrsf13b, Each

$ 1,757.70

Details

The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (tnf) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (caml). The protein induces activation of the transcription factors nfat, ap1, and nf-kappa-b and plays a crucial role in humoral immunity by interacting with a tnf ligand. This gene is located within the smith-magenis syndrome region on chromosome 17. [Provided by refseqsequence: acflkkrgdpcscqprsrprqspakssqdhameagspvstspepvetcsfcfpecraptqesavtpgtpdptcagrwgchtrttvlqpcphipdsglgivcvpaqe

Additional Information

SKU 10288509
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22449