Tnfsf12-Tnfsf13, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tnfsf12-Tnfsf13, Each

Details:

This gene encodes a member of the tumor necrosis factor superfamily. It encodes a hybrid protein composed of the cytoplasmic and transmembrane domains of family member 12 fused to the c-terminal domain of family member 13. The hybrid protein is membrane anchored and presents the receptor-binding domain of family member 13 at the cell surface. It stimulates cycling in t- and b-lymphoma cell lines. [Provided by refseqsequence: leawengersrkrravltqkqkkqhsvlhlvpinatskddsdvtevmwqpalrrgrglqaqgygvriqdagvyllysqvlfqdvtftmgqvvsregqgrqetlfrcirsmpshpdraynscysagvfhlhqgdils