Web Analytics
518-831-8000 sales@utechproducts.com

TNMD, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TNMD, Each

1,757.70

Details:

This gene encodes a protein that is related to chondromodulin-I, which is a cartilage-specific glycoprotein that functions to stimulate chondrocyte growth and to inhibit tube formation of endothelial cells. This protein is also an angiogenesis inhibitor. Genetic variation in this gene is associated with a risk for type 2 diabetes, central obesity and serum levels of systemic immune mediators in a body size-dependent manner. This gene is also a candidate gene for age-related macular degeneration, though a direct link has yet to be demonstrated. [provided by RefSeqSequence: GIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRV

Additional Information

SKU 10288851
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22840