Web Analytics
518-831-8000 sales@utechproducts.com

TOMM22, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TOMM22, Each

1,621.74

Details:

The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion. [provided by RefSeqSequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK

Additional Information

SKU 10292479
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28636