Web Analytics
518-831-8000 sales@utechproducts.com

TOX Rabbit anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TOX, Each

1,757.70

Details:

The protein encoded by this gene contains a HMG box DNA binding domain. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. This protein may function to regulate T-cell developmentSequence: PDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQN

Additional Information

SKU 10287395
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21163