Tox3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tox3, Each

Details:

The protein encoded by this gene contains an hmg-box, indicating that it may be involved in bending and unwinding of dna and alteration of chromatin structure. The c-terminus of the encoded protein is glutamine-rich due to cag repeats in the coding sequence. A minor allele of this gene has been implicated in an elevated risk of breast cancer. Two transcript variants encoding different isoforms have been found for this genesequence: sqgseftpqfppqsldlpsitisrnlveqdgvlhssglhmdqshtqvsqyrqdpslimrsivhmtdaarsgvmp