Tpcn1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tpcn1, Each

Details:

Voltage-gated ca(2 ) and na channels have 4 homologous domains, each containing 6 transmembrane segments, s1 to s6. Tpcn1 is similar to these channels, but it has only 2 domains containing s1 to s6 (ishibashi et al., 2000 [Pubmed 10753632]).[Supplied by omimsequence: fkslllhkrtaiqhayrllisqrrpagisyrqfeglmrfykprmsareryltfkalnqnntpllslkdfydiyevaalkwkakknrehwfdelprt