Web Analytics
518-831-8000 sales@utechproducts.com

TREML1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TREML1, Each

1,757.70

Details:

TREML1 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 (MIM 605085) and TREM2 (MIM 605086), but it has distinct structural and functional properties. TREML1 enhances calcium signaling in an SHP2 (PTPN11; MIM 176876)-dependent manner (Allcock et al., 2003 [PubMed 12645956]; Barrow et al., 2004 [PubMed 15128762]).[supplied by OMIMSequence: KRKQGNRLGVCGRFLSSRVSGMNPSSVVHHVSDSGPAAELPLDVPHIRLDSPPSFDNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVTYATVIFPGGNKGGGTSCGPAQNPPNNQTPSS

Additional Information

SKU 10287166
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20899