Web Analytics
518-831-8000 sales@utechproducts.com

TRIM11, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TRIM11, Each

1,757.70

Details:

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nucleus and the cytoplasm. Its function has not been identified. [provided by RefSeqSequence: LGQQSAHLAELIAELEGRCQLPALGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVETLRRFRGDVTLDP

Additional Information

SKU 10288275
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22174