Web Analytics
518-831-8000 sales@utechproducts.com

TRIM41 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TRIM41, Each

1,757.70

Details:

TRIM41 belongs to a family of tripartite motif (TRIM) proteins defined as containing a RING finger, one or more B-box domains, and a coiled-coil region (Tanaka et al., 2005 [PubMed 16022281]). See TRIM45 (MIM 609318).[supplied by OMIMSequence: RESTHHKEKVGPGGSSVGSGDASSSRHHHRRRRLHLPQQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPSEKPRRFGVYLDYEA

Additional Information

SKU 10287839
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21661