Web Analytics
518-831-8000 sales@utechproducts.com

TRIM7, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TRIM7, Each

1,757.70

Details:

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1, a B-box type 2, and a coiled-coil region. The protein localizes to both the nucleus and the cytoplasm, and may represent a participant in the initiation of glycogen synthesis. Multiple transcript variants have been found for this gene, and some of them encode the same isoform. [provided by RefSeqSequence: LRVLKKELEDCEVFRSTEKKESKELLKQMAAEQEKVGAEFQALRAFLVEQEGRLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQI

Additional Information

SKU 10289437
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23526