Trim7, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Trim7, Each
$ 1,757.70
|
|
Details:
The protein encoded by this gene is a member of the tripartite motif (trim) family. The trim motif includes three zinc-binding domains, a ring, a b-box type 1, a b-box type 2, and a coiled-coil region. The protein localizes to both the nucleus and the cytoplasm, and may represent a participant in the initiation of glycogen synthesis. Multiple transcript variants have been found for this gene, and some of them encode the same isoform. [Provided by refseqsequence: lrvlkkeledcevfrstekkeskellkqmaaeqekvgaefqalraflveqegrllgrleelsrevaqkqnenlaqlgveitqlsklssqi
Additional Information
| SKU | 10289437 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23526 |
