Web Analytics
518-831-8000 sales@utechproducts.com

Trim7, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Trim7, Each

$ 1,757.70

Details

The protein encoded by this gene is a member of the tripartite motif (trim) family. The trim motif includes three zinc-binding domains, a ring, a b-box type 1, a b-box type 2, and a coiled-coil region. The protein localizes to both the nucleus and the cytoplasm, and may represent a participant in the initiation of glycogen synthesis. Multiple transcript variants have been found for this gene, and some of them encode the same isoform. [Provided by refseqsequence: lrvlkkeledcevfrstekkeskellkqmaaeqekvgaefqalraflveqegrllgrleelsrevaqkqnenlaqlgveitqlsklssqi

Additional Information

SKU 10289437
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23526