Triobp Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Triobp, Each

Details:

This gene encodes a protein with an n-terminal pleckstrin homology domain and a c-terminal coiled-coil region. The protein interacts with trio, which is involved with neural tissue development and controlling actin cytoskeleton organization, cell motility and cell growth. The protein also associates with f-actin and stabilizes f-actin structures. Mutations in this gene have been associated with a form of autosomal recessive nonsyndromic deafness. Multiple alternatively spliced transcript variants that would encode different isoforms have been found for this gene, however some transcripts may be subject to nonsense-mediated decay (nmd). [Provided by refseqsequence: eigalmrqaeerehtlrrcqqegqellrhnqelhgrlseeidqlrgfiasqgmgngcgrsnersscelevllrvkenelqylkkevqclrdelqmmqkdkrftsgkyqdvyvelshiktrsereieqlkehlrl