Trip11, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Trip11, Each
$ 1,757.70
|
|
Details:
Trip11 was first identified through its ability to interact functionally with thyroid hormone receptor-beta (thrb; mim 190160). It has also been found in association with the golgi apparatus and microtubules.[Supplied by omimsequence: qslgqvggslasltgqisnftkdmlmegteeveaelpdsrtkeieaihailrsenerlkklctdleekheaseiqikqqstsyrnqlqqkeveishlkarqialqdqllklqsaaqsvpsgagvpattasssfay
Additional Information
| SKU | 10286492 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20125 |
