Web Analytics
518-831-8000 sales@utechproducts.com

Trip11, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Trip11, Each

1,757.70

Details

Trip11 was first identified through its ability to interact functionally with thyroid hormone receptor-beta (thrb; mim 190160). It has also been found in association with the golgi apparatus and microtubules.[Supplied by omimsequence: qslgqvggslasltgqisnftkdmlmegteeveaelpdsrtkeieaihailrsenerlkklctdleekheaseiqikqqstsyrnqlqqkeveishlkarqialqdqllklqsaaqsvpsgagvpattasssfay

Additional Information

SKU 10286492
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20125