Trpv2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Trpv2, Each

Details:

This gene encodes an ion channel that is activated by high temperatures above 52 degrees celsius. The protein may be involved in transduction of high-temperature heat responses in sensory ganglia. It is thought that in other tissues the channel may be activated by stimuli other than heat. [Provided by refseqsequence: rgkldfgsglppmesqfqgedrkfapqirvnlnyrkgtgasqpdpnrfdrdrlfnavsrgvpedlaglpeylsktskyltds