Web Analytics
518-831-8000 sales@utechproducts.com

TSKS, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TSKS, Each

1,757.70

Details:

This gene may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the encoded protein is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression. [provided by RefSeqSequence: LTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDHLSNLPLEGSTGTMGGGSSAGT

Additional Information

SKU 10292210
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28322