Web Analytics
518-831-8000 sales@utechproducts.com

TSPAN13 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TSPAN13, Each

1,757.70

Details:

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeqSequence: ACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEV

Additional Information

SKU 10288070
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21923