Web Analytics
518-831-8000 sales@utechproducts.com

Tspyl2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tspyl2, Each

1,757.70

Details

This gene encodes a member of the testis-specific protein y-encoded, tspy-like/set/nucleosome assembly protein-1 superfamily. The encoded protein is localized to the nucleolus where it functions in chromatin remodeling and as an inhibitor of cell-cycle progression. This protein may play a role in the suppression of tumor growth. [Provided by refseqsequence: nplryylrergsrikrkkqemkkrktrgrcevvimedapdyyavedifseisdidetihdikisdfmettdyfettdneitdinenicdsenpdhnevpnnettdnnesaddhettdnnesaddnnenpednnkntdd

Additional Information

SKU 10289989
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24298