Tspyl2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tspyl2, Each
$ 1,757.70
|
|
Details:
This gene encodes a member of the testis-specific protein y-encoded, tspy-like/set/nucleosome assembly protein-1 superfamily. The encoded protein is localized to the nucleolus where it functions in chromatin remodeling and as an inhibitor of cell-cycle progression. This protein may play a role in the suppression of tumor growth. [Provided by refseqsequence: nplryylrergsrikrkkqemkkrktrgrcevvimedapdyyavedifseisdidetihdikisdfmettdyfettdneitdinenicdsenpdhnevpnnettdnnesaddhettdnnesaddnnenpednnkntdd
Additional Information
| SKU | 10289989 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24298 |
