Tssc4, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tssc4, Each

Details:

This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, An important tumor-suppressor gene region. Alterations in this region have been associated with the beckwith-wiedemann syndrome, wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene is located among several imprinted genes; however, this gene, as well as the pan-hematopoietic expression gene (phemx), escapes imprinting. This gene may play a role in malignancies and disease that involve this region. [Provided by refseqsequence: tkysledvtevseqsnqatalaflgsqslaaptdcvssfnqdpsscgegrviftkpvrgvearherkrvlgkvgepgrgglgnpatd