Tst, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tst, Each
$ 1,757.70
|
|
Details:
The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin. [Provided by refseqsequence: rsllktyeqvlenleskrfqlvdsrsqgrflgtepepdavgldsghirgavnmpfmdfltedgfekgpeelralfqtkkvdlsqpliatcrkgvtachvalaaylcgkpdvavydgswsewfrrappesrvsqgks
Additional Information
| SKU | 10292481 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28638 |
