Web Analytics
518-831-8000 sales@utechproducts.com

TTC7A Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TTC7A, Each

1,757.70

Details:

The tetratricopeptide repeat (TPR) domain is defined by a degenerate consensus sequence of 34 amino acids. TPR domain-containing proteins, such as TTC7A, have diverse functions in cell cycle control, protein transport, phosphate turnover, and protein trafficking or secretion, and they can act as chaperones or scaffolding proteins (White et al., 2005 [PubMed 15718100]).[supplied by OMIMSequence: TSRHLKGCHPLDYELTYFLEAALQSAYVKNLKKGNIVKGMRELREVLRTVETKATQNFKVMAAKHLAGVLLHSLSEECYWSPLSHPLPEFMGKE

Additional Information

SKU 10289027
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23056