Web Analytics
518-831-8000 sales@utechproducts.com

Txn2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Txn2, Each

1,750.95

Details:

This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. [Provided by refseqsequence: ltsralqtpqcspggltvtpnpartiyttrislttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakqhgkvvmakvdiddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkkl

Additional Information

SKU 10286401
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20026