Txnrd1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Txnrd1, Each
|
|
Details:
This gene encodes a member of the family of pyridine nucleotide oxidoreductases. This protein reduces thioredoxins as well as other substrates, and plays a role in selenium metabolism and protection against oxidative stress. The functional enzyme is thought to be a homodimer which uses fad as a cofactor. Each subunit contains a selenocysteine (sec) residue which is required for catalytic activity. The selenocysteine is encoded by the uga codon that normally signals translation termination. The 3' utr of selenocysteine-containing genes have a common stem-loop structure, the sec insertion sequence (secis), that is necessary for the recognition of uga as a sec codon rather than as a stop signal. Alternative splicing results in several transcript variants encoding the same or different isoforms. [Provided by refseqsequence: scedgralegtlselaaetdlpvvfvkqrkigghgptlkayqegrlqkllkmngpedlpksydydliiigggsgglaaakeaaqygkkvmvldfvtptplgtrwglggtcvnvgcipkklmhqaallgqalqdsrnyg
Additional Information
| SKU | 10292309 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28426 |
