Web Analytics
518-831-8000 sales@utechproducts.com

Tysnd1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tysnd1, Each

1,757.70

Details

All peroxisomal proteins are synthesized in the cytosol, and 2 distinct peroxisomal targeting signals (ptss), the c-terminal pts1 and n-terminal pts2, are used for transport of these proteins into peroxisomes. Proteolytic cleavage of the n-terminal targeting sequence of pts2 proteins accompanies import into peroxisomes, and many pts1 proteins undergo c-terminal processing once in the peroxisomal matrix. Tysnd1 processes both pts1 and pts2 proteins involved in beta-oxidation of fatty acids (kurochkin et al., 2007 [Pubmed 17255948]).[Supplied by omimsequence: atqetcpydiavvsleedlddvpipvpaehfhegeavsvvgfgvfgqscgpsvtsgilsavvqvngtpvmlqttcav

Additional Information

SKU 10288775
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22755