Tyw3 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tyw3, Each

Details:

Wybutosine (yw) is a hypermodified guanosine at the 3-prime position adjacent to the anticodon of phenylalanine trna that stabilizes codon-anticodon interactions during decoding on the ribosome. Tyw3 is the human homolog of a yeast gene essential for yw synthesis (noma and suzuki, 2006).[Supplied by omimsequence: efrkwkaqclskadlsrkgsvdedvvelvqflnmrdqffttsscagrillldrgingfevqkqnccwllvthklcvkddviv