Unc13a, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Unc13a, Each
$ 1,356.75
|
|
Details:
Proteins of the unc13 family, such as unc13a, are diacylglycerol and phorbol ester receptors with ligand affinities similar to those of protein kinase c (see prkca; mim 176960). Rodent unc13a is a presynaptic protein with an essential role in synaptic vesicle priming (rossner et al., 2004 [Pubmed 15123597]).[Supplied by omimsequence: qlsedfdpdehslqgsdmederdrdsyhschssvsyhkdsprwdqdeeeleedledfleeee
Additional Information
| SKU | 10282391 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23802 |
