Web Analytics
518-831-8000 sales@utechproducts.com

UNC13A, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant UNC13A, Each

1,356.75

Details:

Proteins of the UNC13 family, such as UNC13A, are diacylglycerol and phorbol ester receptors with ligand affinities similar to those of protein kinase C (see PRKCA; MIM 176960). Rodent Unc13a is a presynaptic protein with an essential role in synaptic vesicle priming (Rossner et al., 2004 [PubMed 15123597]).[supplied by OMIMSequence: QLSEDFDPDEHSLQGSDMEDERDRDSYHSCHSSVSYHKDSPRWDQDEEELEEDLEDFLEEEE

Additional Information

SKU 10282391
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23802