Web Analytics
518-831-8000 sales@utechproducts.com

UQCRQ, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant UQCRQ, Each

2,214.00

Details:

This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain. [provided by RefSeqSequence: REFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRR

Additional Information

SKU 10290176
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24512