Usp30, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Usp30, Each
$ 1,732.05
|
|
Details:
Usp30, a member of the ubiquitin-specific protease family (see usp1, mim 603478), is a novel mitochondrial deubiquitinating (dub) enzyme (nakamura and hirose, 2008 [pubmed 18287522]).[Supplied by omimsequence: ieakgtlngekvehqrttfvkqlklgklpqclcihlqrlswsshgtplkrhehvqfneflmmdiykyhllghkpsqhnpklnknpgptlelqdgpgaptpvlnqpgapktqifmngacspsllptlsapmpfplpvvpdyssst
Additional Information
| SKU | 10282378 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20915 |
Loading Cart Data 