Web Analytics
518-831-8000 sales@utechproducts.com

Usp30, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Usp30, Each

$ 1,732.05

Details

Usp30, a member of the ubiquitin-specific protease family (see usp1, mim 603478), is a novel mitochondrial deubiquitinating (dub) enzyme (nakamura and hirose, 2008 [pubmed 18287522]).[Supplied by omimsequence: ieakgtlngekvehqrttfvkqlklgklpqclcihlqrlswsshgtplkrhehvqfneflmmdiykyhllghkpsqhnpklnknpgptlelqdgpgaptpvlnqpgapktqifmngacspsllptlsapmpfplpvvpdyssst

Additional Information

SKU 10282378
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20915