Web Analytics
518-831-8000 sales@utechproducts.com

USP36, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant USP36, Each

1,810.35

Details:

Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP36 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).[supplied by OMIMSequence: DSLVHSSNVKVVLNQQAYVLFYLRIPGSKKSPEGLISRTGSSSLPGRPSVIPDHSKKNIGNGIISSPLTGKRQDSGTMKKPHTTEEIGVPISRNGSTLGLKSQNGCIPPKLPSGSPSPKLSQTPTHMPTILDDPGKKVKKPAPP

Additional Information

SKU 10282377
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20583