Usp40, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Usp40, Each

Details:

Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. Usp40 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (quesada et al., 2004 [Pubmed 14715245]).[Supplied by omimsequence: nlcqleseekqvkisatvntmvfdirikaikelklmkeladnsclrpidrngkllcpvpdsytlkeaelkmgsslglclgkapsssqlflffamgsdvqpgtemeivveetisvrdclklmlkksglqgdawhlrkmdwcyeagep