Ust, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ust, Each
$ 1,757.70
|
|
Details:
Uronyl 2-sulfotransferase transfers sulfate to the 2-position of uronyl residues, such as iduronyl residues in dermatan sulfate and glucuronyl residues in chondroitin sulfate (kobayashi et al., 1999 [Pubmed 10187838]).[Supplied by omimsequence: ynrvgkcgsrtvvlllrilsekhgfnlvtsdihnktrltkneqmeliknistaeqpylftrhvhflnfsrfg
Additional Information
| SKU | 10288647 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22603 |
