Uts2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Uts2, Each
$ 1,757.70
|
|
Details:
This gene encodes a mature peptide that is an active cyclic heptapeptide absolutely conserved from lamprey to human. The active peptide acts as a vasoconstrictor and is expressed only in brain tissue. Despite the gene family name similarity, this gene is not homologous to urocortin, a member of the sauvagine/corticotropin-releasing factor/urotensin i family. Most of the proprotein is cleaved to make the mature peptide. Transcript variants encoding different preproprotein isoforms have been described for this gene. [Provided by refseqsequence: tnvfhlmlcvtsarthkstslcfghfnsypslplihdllleisfqlsaphedarltpeelerasllqilpemlgaergdilrkadsstnifnprgnlrkfqdfsgqdpnillshllariwkpykkretpdcfwkycv
Additional Information
| SKU | 10287179 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20916 |
