Web Analytics
518-831-8000 sales@utechproducts.com

UTY, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant UTY, Each

1,750.95

Details:

This gene encodes a protein containing tetratricopeptide repeats which are thought to be involved in protein-protein interactions. This protein is a minor histocompatibility antigen which may induce graft rejection of male stem cell grafts. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeqSequence: SNSCILLDKCPPPRPPTSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPKNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWRCESNRSHTTI

Additional Information

SKU 10286409
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20036