Uxs1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Uxs1, Each
$ 1,318.98
|
|
Details:
Udp-glucuronate decarboxylase (ugd; ec 4.1.1.35) Catalyzes the formation of udp-xylose from udp-glucuronate. Udp-xylose is then used to initiate glycosaminoglycan biosynthesis on the core protein of proteoglycans.[Supplied by omimsequence: mrsiqengelkieskieemveplrekirdleksftqkyppvkflsekdrkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdv
Additional Information
| SKU | 10286782 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20451 |
