Vezf1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Vezf1, Each

Details:

Transcriptional regulatory proteins containing tandemly repeated zinc finger domains are thought to be involved in both normal and abnormal cellular proliferation and differentiation. Znf161 is a c2h2-type zinc finger protein (koyano-nakagawa et al., 1994 [Pubmed 8035792]). See mim 603971 for general information on zinc finger proteins.[Supplied by omimsequence: rlweeavkarkkeaanlcqtstaattpvtlttpfsitssvssgtmsnpvtvaaamsmrspvnvssavnitspmnighpvtitsplsmtspltlttpvnlptpvtapvniahpvtitspmnlptpmtlaaplniamrpves