Vpreb3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Vpreb3, Each

Details:

The protein encoded by this gene is the human homolog of the mouse vpreb3 (8hs20) protein, and is specifically expressed in cell lines representative of all stages of b-cell differentiation. It is also related to vpreb1 and other members of the immunoglobulin supergene family. This protein associates with membrane mu heavy chains early in the course of pre-b cell receptor biosynthesis. The precise function of the protein is not known, but it may contribute to mu chain transport in pre-b cells. [Provided by refseqsequence: qldallvfpgqvaqlsctlspqhvtirdygvswyqqragsapryllyyrseedhhrpadipdrfsaakdeahnacvltispvqpeddadyycsvgygfsp