Web Analytics
518-831-8000 sales@utechproducts.com

VPREB3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant VPREB3, Each

1,757.70

Details:

The protein encoded by this gene is the human homolog of the mouse VpreB3 (8HS20) protein, and is specifically expressed in cell lines representative of all stages of B-cell differentiation. It is also related to VPREB1 and other members of the immunoglobulin supergene family. This protein associates with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. The precise function of the protein is not known, but it may contribute to mu chain transport in pre-B cells. [provided by RefSeqSequence: QLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP

Additional Information

SKU 10292480
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28637