Vta1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Vta1, Each
$ 1,757.70
|
|
Details:
C6orf55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes (ward et al., 2005 [Pubmed 15644320]).[Supplied by omimsequence: fksiqhhlrtaqehdkrdpvvayycrlyamqtgmkidsktpecrkflsklmdqlealkkqlgdnea
Additional Information
| SKU | 10288555 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22500 |
