Web Analytics
518-831-8000 sales@utechproducts.com

VTA1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant VTA1, Each

1,757.70

Details:

C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes (Ward et al., 2005 [PubMed 15644320]).[supplied by OMIMSequence: FKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEA

Additional Information

SKU 10288555
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22500