Wasf1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Wasf1, Each
|
|
Details
The protein encoded by this gene, a member of the wiskott-aldrich syndrome protein (wasp)-family, plays a critical role downstream of rac, a rho-family small gtpase, in regulating the actin cytoskeleton required for membrane ruffling. It has been shown to associate with an actin nucleation core arp2/3 complex while enhancing actin polymerization in vitro. Wiskott-aldrich syndrome is a disease of the immune system, likely due to defects in regulation of actin cytoskeleton. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [Provided by refseqsequence: praphdrrrewqklaqgpelaeddanllhkhievangpashfetrpqtyvdhmdgsyslsalpfsqmselltraeervlvrpheppppppmhgagdakpiptcissatglienrpqspatgrtpvfvsptp
Additional Information
| SKU | 10286618 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20262 |
