Wbp4, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Wbp4, Each

Details:

This gene encodes ww domain-containing binding protein 4. The ww domain represents a small and compact globular structure that interacts with proline-rich ligands. This encoded protein is a general spliceosomal protein that may play a role in cross-intron bridging of u1 and u2 snrnps in the spliceosomal complex a. [Provided by refseqsequence: yckcwiadnrpsvefhergknhkenvakriseikqksldkakeeekaskefaameaaalkayqedlkrlgleseilepsitpvtstipptstsnqqkek