Web Analytics
518-831-8000 sales@utechproducts.com

WBP4, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant WBP4, Each

1,757.70

Details:

This gene encodes WW domain-containing binding protein 4. The WW domain represents a small and compact globular structure that interacts with proline-rich ligands. This encoded protein is a general spliceosomal protein that may play a role in cross-intron bridging of U1 and U2 snRNPs in the spliceosomal complex A. [provided by RefSeqSequence: YCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEK

Additional Information

SKU 10289302
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23372