Web Analytics
518-831-8000 sales@utechproducts.com

Wbp4, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Wbp4, Each

$ 1,757.70

Details

This gene encodes ww domain-containing binding protein 4. The ww domain represents a small and compact globular structure that interacts with proline-rich ligands. This encoded protein is a general spliceosomal protein that may play a role in cross-intron bridging of u1 and u2 snrnps in the spliceosomal complex a. [Provided by refseqsequence: yckcwiadnrpsvefhergknhkenvakriseikqksldkakeeekaskefaameaaalkayqedlkrlgleseilepsitpvtstipptstsnqqkek

Additional Information

SKU 10289302
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23372