Wbscr27, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Wbscr27, Each
$ 1,318.98
|
|
Details:
This gene encodes a protein belonging to ubie/coq5 methyltransferase family. The gene is deleted in williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.22-Q11.23. [Provided by refseqsequence: lttrtnssnlqykealeatldrleqagmweglvawpvdrlwtagswlppswrwypaslprmasspalstctesg
Additional Information
| SKU | 10287682 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21492 |
