Web Analytics
518-831-8000 sales@utechproducts.com

WDR17, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant WDR17, Each

1,757.70

Details:

This gene encodes a WD repeat-containing protein. It is abundantly expressed in retina and testis. Alternatively spliced transcript variants have been found for this gene, and they encode distinct isoforms. [provided by RefSeqSequence: EDVVAFVSHRGPLFIWTISGPDSGVIVHKDAHSFLSDICMFRWHTHQKGKVVFGHIDGSLSIFHPGNKNQKHVLRPESLEGTDEEDPVTALEWDPLST

Additional Information

SKU 10289840
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23975