Web Analytics
518-831-8000 sales@utechproducts.com

WDR23, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant WDR23, Each

1,757.70

Details:

This gene encodes a WD repeat-containing protein that interacts with the COP9 signalosome, a macromolecular complex that interacts with cullin-RING E3 ligases and regulates their activity by hydrolyzing cullin-Nedd8 conjugates. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq]Sequence: NSKDQTIKLWDIRRFSSREGMEASRQAATQQNWDYRWQQVPKKAWRKLKLPGDSSLMTYRGHGVLHTLIRCRFSPIHSTGQQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDG

Additional Information

SKU 10288575
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22521