Web Analytics
518-831-8000 sales@utechproducts.com

Wdr23, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Wdr23, Each

$ 1,757.70

Details

This gene encodes a wd repeat-containing protein that interacts with the cop9 signalosome, a macromolecular complex that interacts with cullin-ring e3 ligases and regulates their activity by hydrolyzing cullin-nedd8 conjugates. Multiple alternatively spliced transcript variants have been found for this gene. [Provided by refseq]sequence: nskdqtiklwdirrfssregmeasrqaatqqnwdyrwqqvpkkawrklklpgdsslmtyrghgvlhtlircrfspihstgqqfiysgcstgkvvvydllsghivkkltnhkacvrdvswhpfeekivssswdg

Additional Information

SKU 10288575
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22521