Wdr23, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Wdr23, Each

Details:

This gene encodes a wd repeat-containing protein that interacts with the cop9 signalosome, a macromolecular complex that interacts with cullin-ring e3 ligases and regulates their activity by hydrolyzing cullin-nedd8 conjugates. Multiple alternatively spliced transcript variants have been found for this gene. [Provided by refseq]sequence: nskdqtiklwdirrfssregmeasrqaatqqnwdyrwqqvpkkawrklklpgdsslmtyrghgvlhtlircrfspihstgqqfiysgcstgkvvvydllsghivkkltnhkacvrdvswhpfeekivssswdg