Web Analytics
518-831-8000 sales@utechproducts.com

WDR92 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant WDR92, Each

1,757.70

Details:

The WD40 repeat domain is a common structural module in eukaryotes, and proteins containing WD40 domains have a diverse range of functions, including signal transduction, cell cycle regulation, RNA splicing, and transcription (Saeki et al., 2006 [PubMed 16487927]).[supplied by OMIMSequence: YNQEERVVCAGYDNGDIKLFDLRNMALRWETNIKNGVCSLEFDRKDISMNKLVATSLEGKFHVFDMRTQHPTK

Additional Information

SKU 10291894
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27846