Web Analytics
518-831-8000 sales@utechproducts.com

WIPF1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant WIPF1, Each

1,757.70

Details:

This gene encodes a protein that plays an important role in the organization of the actin cytoskeleton. The encoded protein binds to a region of Wiskott-Aldrich syndrome protein that is frequently mutated in Wiskott-Aldrich syndrome, an X-linked recessive disorder. Impairment of the interaction between these two proteins may contribute to the disease. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeqSequence: PPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPPDRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNRRERGAP

Additional Information

SKU 10287330
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21090