Wipf1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Wipf1, Each

Details:

This gene encodes a protein that plays an important role in the organization of the actin cytoskeleton. The encoded protein binds to a region of wiskott-aldrich syndrome protein that is frequently mutated in wiskott-aldrich syndrome, an x-linked recessive disorder. Impairment of the interaction between these two proteins may contribute to the disease. Two transcript variants encoding the same protein have been identified for this gene. [Provided by refseqsequence: ppppvsrngstsralpatpqlpsrsgvdsprsgprpplppdrpsagappppppstsirngfqdspcedewesrfyfhpisdlpppepyvqttksypsklarnesrsgsnrrergap