Wipf2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Wipf2, Each

Details:

This gene encodes a wasp interacting protein (wip)-related protein. It has been shown that this protein has a role in the wasp-mediated organization of the actin cytoskeleton and that this protein is a potential link between the activated platelet-derived growth factor receptor and the actin polymerization machinery. [Provided by refseqsequence: pvnirtgpsgqslapppppyrqppgvpngpssptnesapelpqrhnslhrktpgpvrglapppptsaspsllsnrppp