Web Analytics
518-831-8000 sales@utechproducts.com

WIPF2 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant WIPF2, Each

1,757.70

Details:

This gene encodes a WASP interacting protein (WIP)-related protein. It has been shown that this protein has a role in the WASP-mediated organization of the actin cytoskeleton and that this protein is a potential link between the activated platelet-derived growth factor receptor and the actin polymerization machinery. [provided by RefSeqSequence: MQRPSLPDLSRPNTTSSTGMKHSSSAPPPPPPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPP

Additional Information

SKU 10287814
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21634