Web Analytics
518-831-8000 sales@utechproducts.com

WRAP73, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant WRAP73, Each

1,757.70

Details:

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Studies of the related mouse protein suggest that the encoded protein may play a role in the process of ossification. [provided by RefSeqSequence: SVPVSLQTLKPVTDRANPKIGIGMLAFSPDSYFLATRNDNIPNAVWVWDIQKLRLFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQVPGEGDFAVLSLCWHLSGDSM

Additional Information

SKU 10288120
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21986