Wrap73, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Wrap73, Each
$ 1,757.70
|
|
Details:
This gene encodes a member of the wd repeat protein family. Wd repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (gh-wd), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Studies of the related mouse protein suggest that the encoded protein may play a role in the process of ossification. [Provided by refseqsequence: svpvslqtlkpvtdranpkigigmlafspdsyflatrndnipnavwvwdiqklrlfavleqlspvrafqwdpqqprlaictggsrlylwspagcmsvqvpgegdfavlslcwhlsgdsm
Additional Information
| SKU | 10288120 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21986 |
