Web Analytics
518-831-8000 sales@utechproducts.com

WRNIP1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant WRNIP1, Each

1,757.70

Details:

Werner's syndrome is a rare autosomal recessive disorder characterized by premature aging. The protein encoded by this gene interacts with the N-terminal portion of Werner protein containing the exonuclease domain. This protein shows homology to replication factor C family proteins, and is conserved from E. coli to human. Studies in yeast suggest that this gene may influence the aging process. Two transcript variants encoding different isoforms have been isolated for this gene. [provided by RefSeqSequence: YQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKARLRNHQGPLPPVPLHLRNAPTRLMKDLGYG

Additional Information

SKU 10288631
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22586