Web Analytics
518-831-8000 sales@utechproducts.com

XPNPEP2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant XPNPEP2, Each

1,757.70

Details:

Aminopeptidase P is a hydrolase specific for N-terminal imido bonds, which are common to several collagen degradation products, neuropeptides, vasoactive peptides, and cytokines. Structurally, the enzyme is a member of the 'pita bread fold' family and occurs in mammalian tissues in both soluble and GPI-anchored membrane-bound forms. A membrane-bound and soluble form of this enzyme have been identified as products of two separate genes. [provided by RefSeqSequence: VRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGI

Additional Information

SKU 10287319
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21077