Xpo6, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Xpo6, Each

Details:

Exportins, such as xpo6, recruit cargo in the nucleoplasm in the presence of ran (mim 601179)-gtp and form ternary export complexes. These complexes are transported through nuclear pore complexes to the cytoplasm, where gtp is hydrolyzed and the export complex is disassembled.[Supplied by omimsequence: rpspdvkaelfellfrtlhhnwryffkstvlasvqrgiaeeqmenepqfsaimqafgqsflqpdihlfkqnlfyletlntkqklyhkk