Zbtb16 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Zbtb16, Each
$ 1,757.70
|
|
Details:
This gene is a member of the krueppel c2h2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (apl). Alternate transcriptional splice variants have been characterized. [Provided by refseqsequence: hytldflspktfqqileyaytatlqakaedlddllyaaeileieyleeqclkmletiqasddndteatmadggaeeeedrkarylknifiskhsseesgyasvagqslpgpmvdqspsvstsfglsa
Additional Information
| SKU | 10292327 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28445 |
