Web Analytics
518-831-8000 sales@utechproducts.com

Zbtb16 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Zbtb16, Each

1,757.70

Details

This gene is a member of the krueppel c2h2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (apl). Alternate transcriptional splice variants have been characterized. [Provided by refseqsequence: hytldflspktfqqileyaytatlqakaedlddllyaaeileieyleeqclkmletiqasddndteatmadggaeeeedrkarylknifiskhsseesgyasvagqslpgpmvdqspsvstsfglsa

Additional Information

SKU 10292327
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28445